SSGCID - LpboA.00118.a Nucleoside-diphosphate-sugar pyrophosphorylase

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
2695CompleteStructure predictionssgcidSSGCID - LpboA.00118.a Nu...2379 Apr 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  
   sequence: MSKRAVILAGGKGTRLRPYTTVFPKPLMPIGEYPILEVIVKQLVKSGFSHITLAVNHQAQLIQAFFQDGSRWNTKIDYSLEDKPLGTMGPLKLISDLPNDFLVMNGDVLTDIDFANFYQVHVQSKSIFTISSKKRQQMIDYGVLETDNDGLLSGFREKPAQSYEVSMGVYMVSQAALNFIPEDSVFGFDNLMLKLIELDKPVSVRPHEGYWLDIGRPDDYEKAIDEFEIMKDTLFHD
 deepconcnf: ---EEEEEE------------------EEE--HHHHHHHHHHHHH----EEEEEE---HHHHHHH--------EEEEEEEE-------------------EEEEE--------HHHHHHHHHH----EEEEEEE------EEEEEE-----EEEEEE-------EEEEEEEE---------------HHHHHHHHHH----EEEEEE---EEE---HHHHHHHHHHHHH-HHHH---
    psipred: ----EEEE--------------------EE----HHHHHHHHHHH----EEEEE----HHHHHHHH---HH---EEEEEE------HHHHHHH-------EEEEE--------HHHHHHHHHH----EEEEEEEEE-----EEEEE----EEEEEEE------EEEEEEEEE-HHHHHH--------HHHHHHHHHH----EEEEE----EE----HHHHHHHHHHHHHHHHHH---
    spider3: ---EEEEEE-------------------EE--EEHHHHHHHHHHH----EEEEE----HHHHHHHH--HHH---EEEEEE-------HHHHHHH------EEEEE--------HHHHHHHHHH----EEEEEEEE------EEEEE-----EEEEEE------EEEEEEEEE-HHHHHH--------HHHHHHHHHH----EEEEE----------HHHHHHHHHHHHHHHHHH---
   disopred: D-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
2893110.81comparative modeling1-23723712 Apr 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington