2018-05-26_00000090_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
265CompleteStructure predictionrobetta_beta2018-05-26_00000090_1_1917626 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    . 
   sequence: AKEGGLNVGQRNTQDAMSLLRTGDAALGSISNILLRMRDLATQAANGTNNATDTDSLDKEYVQLKDEIDHIAGKTNFNGNSFLDTTATPPGKDIEIQLSDASGDTMTLKAIDTKSLTTGTLTNLKDRATAETEITKLDTAIQKINDERATFGSQLNRLDHNLNNVTSQATNMAAAA
 deepconcnf: ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHH-----EE------------EEEEEEE--------------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-
    psipred: ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHHHHHH-----EE------------EEEEEE----HH---------------------HHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHH--
    spider3: --H--HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHHHHHHHHH-EE---E------------EEEE-----HHHHHHHHH---------------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-
   disopred: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------D-DDDDD
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
394110.83comparative modeling1-17617626 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington