T0956_skip_domain_parser

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
250CompleteStructure predictioncaspT0956_skip_domain_parser17825 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .   
   sequence: SATMAFHPMLCRLELSVSAAPPASPIDATLLRSLITSVLNSSWVDLGGNTANEKVLCAIGLIEAFCRERVIPPTSNSFNTSVTYHIMVEDLDPDDLGNIQLINKPLLSLEGDLKVLGSYQLTFQTIPGHSEPRSMTDNGIYHSDSPFFQIALGHALLGTGKIYDHITRALRVAPITIA
 deepconcnf: ---------EEEEEEEEEE------HHHHHHHHHHHHHHH---EE-----HHHHHHHHHHHHHHHH---------------EEEEEEEE---------EEEEE---------EEEEEEEEEEEEE--------------------HHHHHHHHHHHH---HHHHHHHHHH--------
    psipred: -------HHHEEEEEEE--------HHHHHHHHHHHHHHH---EE--------EEEEHHHHHHHHHH--------------EEEEEEE-----HH---EEEE---HH------EEEEEEEEEEEE--------------EE----HHHHHHHHHHHH---HHHHHHHHHHH----EE-
    spider3: ---------EEEEEEEE----------HHHHHHHHHHHH-------------HHHHHHHHHHHHHHH--------------EEEEEEEE---------EEEE----E-----EEEEEEEEEEEEE--------------------HHHHHHHHHHHH-----HHHHHHEEEE------
   disopred: DDD-----------------------------------------------------------------------------------------------------------------------------DDDDDDDDDD----------------------------------------
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
383110.03comparative modeling1-17817825 May 2018
38412n/aab initio1-17817825 May 2018



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington