T0974s1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
248CompleteStructure predictioncaspT0974s17225 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70  
   sequence: MSYDYSSLLGKITEKCGTQYNFAIAMGLSERTVSLKLNDKVTWKDDEILKAVHVLELNPQDIPKYFFNAKVH
 deepconcnf: ----HHHHHHHHHH----HHHHHHHH---HHHHHHHH-------HHHHHHHHHHH------HHHHH------
    psipred: --HHHHHHHHHHHH----HHHHHHHH---HHHHHHHH-------HHHHHHHHHHH---HHHHHHH-------
    spider3: ----HHHHHHHHHH----HHHHHHHH---HHHHHHHH-------HHHHHHHHHHH---HHHHHHHH------
   disopred: DDD---------------------------------------------------------------------
      tmhmm: ------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
381110.88comparative modeling1-727225 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington