T0970

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
243CompleteStructure predictioncaspT09709723 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  
   sequence: KRSGFLTLGYRGSYVARIMVCGRIALAKEVFGDTLNESRDEKYTSRFYLKFTYLEQAFDRLSEAGFHMVACNSSGTAAFYRDDKIWSSYTEYIFFRP
 deepconcnf: ---EEEEEEEE-----EEEEE--HHHHHHHHHHH---------EEEEE-----HHHHHHHHHH---EEEEEE----------------EEEEEEE--
    psipred: ----EEEEEE------EEEEE---HHHHHH--HHH-------EEEEEE-----HHHHHHHHHH---EEEEE------------------EEEEEE--
    spider3: ----EEEEEE----EEEEEEE-EHHHHHHHHHHHH--------EEEEE-----HHHHHHHHHH---EEEEEE---------------EEEEEEEE--
   disopred: DD-----------------------------------------------------------------------------------------------
      tmhmm: -------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
376110.29comparative modeling1-979724 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington