2018-05-20_00000077_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
235CompleteStructure predictionrobetta_beta2018-05-20_00000077_1_1925520 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .
   sequence: GPMADIGSLLQDSDSLSGSYLDPNYQSIKWQPHQQNKWATLYDANYKELPMLTYRVDADKGFNFSVGDDAFVCQKKNHFQVTVYIGMLGEPKYVKTPEGLKPLDCFYLKLHGVKLEALNQSINIEQSQSDRSKRPFNPVTVNLPPEQVTKVTVGRLHFSETTANNMRKKGKPNPDQRYFMLVVALQAHAQNQNYTLAAQISERIIVRASNPGQFESDSDVLWQRAQVPDTVFHHGRVGINTDRPDEALVVHGNVK
 deepconcnf: ---------------------------EEEE------EEEEE-----E----EEEEE-----EEE-----EEEE----EEEEEEEEE----EEEE-----EEEEEEEEEEEEEEE---EEEEEEE-------------EEEE-----EEEEEEEEEEEEE-----------------EEEEEEEEEEEE--EEEEEEEEE---EEEEE----------------------EEEE-EEEE--------EEEEEEE-
    psipred: ---------------------------EEEE-------EEEE----------EEEEEE------------EEEEE---EEEEEEEEE-----EEEE----EEEEEEEEEEEEEE-----EEEE----------------EEE-----EEEEEE-----------------------EEEEEEEEEEEEE----EEEEEE----EEEE-----------------------EEE--------------EE------
    spider3: ----------------------------EEE------EEEEE-----E----EEEEE-----EE-------EEE---EEEEEEEEEE-----EEE----EEEEEEEEEEEEEEEE-----EEEEE-----------------------EEEEE-EEEEEE-------------HHHHEEEEEEEEEEEE----EEEEEEEE---E-------------------------EEE--EEE--------HEEE-----
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDD------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDD---------------------------------------------------------------------------DDDDDDDDDDDDDDDDDDDDD-----------------DD
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
362110.71comparative modeling1-25525521 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington