2018-05-20_00000047_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
226CompleteStructure predictionrobetta_beta2018-05-20_00000047_1_1920520 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .
   sequence: SGSGMYRNFLKRVIDILGALFLLILTSPIIIATAIFIYFKVSRDVIFTQARPGLNEKIFKMYKFKTMSDERDANGELLPDDQRLGKFGKLIRSLSLDELPQLFNVLKGDMSFIGPRPLLVEYLPIYNETQKHRHDVRPGITGLAQVNGRNAISWEKKFEYDVYYAKNLSFMLDVKIALMTIEKVLKRSGVSKEGQATTEKFNGKN
 deepconcnf: ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEEEEE-------EEEEEEEEE-------------------HHHHHHHH-----HHHHHHHHH---EEE--------------HHHHHH--------EEEE--------HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHH------------------
    psipred: ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH----EEEEEE-------EEEEEEE---------------------HHHHHHHH--HHHHHHHHHHHH--EEEE------HHHHHH--HHHHHH---------HHH--------HHHHHHHH-HH---HHHHHHHHHHHHHHHHHEE-------------------
    spider3: ----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----------------EEEEEEEEE-------------------HHHHHHHHH-HHHHHHHHHHHH-H-H--------HHHHHH--HHHHHHHH-------HHHH-------HHHHHHHHHHHHHH--HHHHHHHHHHHHHHHH--------------------
   disopred: DDDD---D---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDD-DDD
      tmhmm: ----------------TTTTTTTTTTTTTTTTTTTTTTT----------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
350110.86comparative modeling1-20520520 May 2018
35112n/aab initio1-20520520 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington