2018-05-20_00000046_2_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
225CompleteStructure predictionrobetta_beta2018-05-20_00000046_2_1911120 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110 
   sequence: GHMPSPSQLDQSVLEALPPDLREQVEQVCAVQQAESHGDKKKEPVNGCNTGILPQPVGTVLLQIPEPQESNSDAGINLIALPAFSQVDPEVFAALPAELQRELKAAYDQRQ
 deepconcnf: ----------HHHH----HHHHHHHHHHHHHHH-------------------------------------------------------HHHH----HHHHHHHHHHHHH--
    psipred: ----------HHHHHH--HHHHHHHHHHHHHH--------------------------------------------------------HHHHHH--HHHHHHHHHHHHH--
    spider3: -----HHH--HHHHH---HHHHHHHHHHHHHHHHH------------------------------------------------HHH--HHHHH---HHHHHHHHHHHHH--
   disopred: ------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD---------------------DDDDD
      tmhmm: ---------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
360110.17comparative modeling1-11111121 May 2018
36112n/aab initio1-11111121 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington