2018-05-20_00000043_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
224CompleteStructure predictionrobetta_beta2018-05-20_00000043_1_196920 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .    
   sequence: GHMSAYMLWLNASREKIKSDHPGISITDLSKKAGEIWKGMSKEKKEEWDRKAEDARRDYEKAMKEYEGG
 deepconcnf: ----HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHH--
    psipred: ----HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHH--
    spider3: ----HHHHHHHHHHHHHHHH-----HHHHHHHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHH--
   disopred: -------------------------------------------------------------------DD
      tmhmm: ---------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
345110.98comparative modeling1-696920 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington