Braziliase-II

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16911ExpiredStructure prediction aleffBraziliase-II12225 Feb 202029 Mar 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120  
   sequence: NLWQFEMLIMKIAKTSGFMFYSSYGCYCGWGGHGRPQDAADRCCFVHDCCYGKVTKCNPKWDIYTYSEENGVVVCGGDDPCKKQICECDRVAATCFRDNKDTYDNKYWFFPAKNCQEESEPC
    psipred: -HHHHHHHHHHHH---HHHHH-----------------HHHHHHHHHHHHHHH------EEE-EEEEEE--EEEE----HHHHHHHHHHHHHHHHHHH----HHHHHH---HHH--------
 deepconcnf: -HHHHHHHHHHHH--------------------------------------------------EEEEEE--EEEE------HHHHHHHHHHHHHHHHH------------------------
    spider3: -HHHHHHHHHHHH---HHHHH-----------------HHHHHHHH---HHHH------EE--EEEEEE--EEEE----HHHHHHHHHHHHHHHHHHH------HHH----HHH--------
   disopred: ---------------------------------------------------------------------------------------------------------------------DDDDD
      tmhmm: --------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16739110.99comparative modeling1-12212225 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington