N term RibR

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16907ExpiredStructure prediction sprasavaN term RibR9225 Feb 202029 Mar 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90  
   sequence: MTIIAGTVVKGKQLGRKLGFPTANVDAKIHGLRNGVYGVLATVNHQFHLGVMNIGVKPTVGSNLEKTLEIFLFDFHRDIYGEKIECSILFKI
 deepconcnf: -EEEEEEEEE------EE------EE---------EEEEEEEE--EEEEEEEEEE----------EEEEEEEEE--------EEEEEEEEE-
    psipred: -EEEEEEEEE-------------------------EEEEEEEE--EEEEEEEEE-----------EEEEEEEE---------EEEEEEEEE-
    spider3: --EEEEEEE-------E-----EEE---------EEEEEEEEE--EEEEEEEEEEE----------EEEEEEE---------EEEEEEEEE-
   disopred: --------------------------------------------------------------------------------------------
      tmhmm: --------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16722110.85comparative modeling1-929225 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington