NiV_V_ZnMotif

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16905ExpiredStructure prediction ThilagaNiV_V_ZnMotif4825 Feb 202028 Mar 2020
             1   .   10    .   20    .   30    .   40    .   
   sequence: HRREISICWDGKRAWVEEWCNPACSRITPLPRRQECQCGECPTECFHC
    psipred: ---EEEEEEE--EEEEEE-------------EEEEEE-----------
    spider3: ---EEEEEEE--EEEEEEE------------EEEE-------------
 deepconcnf: --EEEEEEEE--EEEE--------------------------------
   disopred: ------------------------------------------------
      tmhmm: ------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16732110.39ab initio1-484825 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington