UBX_domain

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16904ExpiredStructure prediction ThilagaUBX_domain8325 Feb 202028 Mar 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80   
   sequence: YDQCRIQVRLPDGTSLTQTFRAREQLAAVRLYVELHRGEELGGGQDPVQLLSGFPRRAFSEADMERPLQELGLVPSAVLIVAK
 deepconcnf: ---EEEEEE-----EEEEEEE----HHHHHHHHHHH-----------EEEEE------------------------EEEEEE-
    spider3: --EEEEEEE-----EEEEEE----EHHHHHHHHHHH------------EEE---------H-----EHHHH-----EEEEEE-
    psipred: --EEEEEEE-----EEEEEE-----HHHHHHHHHHH-----------EEEE----------------HHH------EEEEEE-
   disopred: -----------------------------------------------------------------------------------
      tmhmm: -----------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16720110.67ab initio1-838325 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington