chrXIII_plus_480921-481187_0

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16900ExpiredStructure prediction cgpapadochrXIII_plus_480921-48118...8725 Feb 202029 Mar 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .  
   sequence: MISMEAINNFIKTAPKHDYLTGGVHHSGNVDVLQLSGNKEDGSLVWNHTFVDVDNNVVAKFEDALEKLESLHRRSSSSTGNEEHANV
    spider3: -----------------------------EEEEEE--------EEE-EEEE-----EEEEHHHHHHHHHHH----------------
 deepconcnf: ---HHHHHHHHHH----------EEEEEEEEEEEEE-------EEEEEEEEE----HHHHHHHHHHHHHHHHH--------------
    psipred: ---HHHHHHHHH------EE---------EEEEEE--------EEEEEEEEE----HHHHHHHHHHHHHHHH---------------
   disopred: DDDDD-D-----------------------------------------------------------DDDDDDDDDDDDDDDDDDDDD
      tmhmm: ---------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16708110.39ab initio1-878725 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington