MANA-229-ALL-I

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16896ExpiredStructure prediction manauMANA-229-ALL-I22925 Feb 202028 Mar 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .    
   sequence: SNIDPSAQIDPSAYIHPTVIVGGNTQIGQNTQIGPNVGIGNGVQIGQNTQIGGNVGIGNGTQIGQNTQIGPNVGIGNGVQIGQNTQIGGNVGIGNGTQIGQNTQIGHNVGIHGGVQIGQNTQIGGNVGIGNGTQIGQNTQIGPNVGIGNGVQIGQNTQIGGNVGIGNGTQIGQNTQIGPNVGIGNGVQIGQNTQIGGNTVIGNGVQVPPNATVPGNYVVGSAEAAKKLK
 deepconcnf: -------------------EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE---------------EEEE--EEE----EE----EE----EE----EE---EEE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE-------HHHHHHH--
    psipred: -EE----EE----------EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE------------------EEEEEE----EE----EE----EE----EEE--EEEE---EE----EEEE---EEEE-EE----EE--EEEE----EE----EEEE--------------EEEE-----HHHHHHH--
    spider3: -------EE----------EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE----EE-----------------EE-EEEE---EEE-----E--HHEE----EE---EEEE--EEE---EEEEEEEEE---EEE---EEEE--EEE---EEE----EEEE--------------EE-------HHHHHHH--
   disopred: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD--DDD
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
16728110.85comparative modeling1-22922925 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington