1uva 1.pdb

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
16886ExpiredStructure prediction chole1uva 1.pdb27325 Feb 202026 Mar 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270   
   sequence: MSILEKITSSPSECAEHLTNKDSCLSKKIQKELTSFLEKKETLGCDSESCVITHPAVKAYAQQKGLDLSKELETRFKAPGPRNNTGLLTNFNIDETLQRWAIKYTKFFNCPFSMMDFERVHYKFNQVDMVKVYKGEELQYVEGKVVKRPCNTFGCVLNTDFSTGTGKHWVAIFVDMRGDCWSIEYFNSAGNSPPGPVIRWMERVKQQLLKIHHTVKTLAVTNIRHQRSQTECGPYSLFYIRARLDNVSYAHFISARITDEDMYKFRTHLFRIA
   disopred: DDDDDD-D------------------------------------------------------DDDDD------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| Download | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
1670211n/acomparative modeling1-27327325 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington