SSGCID - BewuA.18928.a.10 nsp9

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
15668CompleteStructure prediction ssgcidSSGCID - BewuA.18928.a.10...1138 Feb 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110   
   sequence: NNELSPVALRQMSCAAGTTQTACTDDNALAYYNTTKGGRFVLALLSDLQDLKWARFPKSDGTGTIYTELEPPCRFVTDTPKGPKVKYLYFIKGLNNLNRGMVLGSLAATVRLQ
 deepconcnf: ---------EEEEEE-------------EEEEEE----EEEEEEEE-----EEEEEE------EEEEEE----EEEEE-----EEEEEEEE-------HHHHEEEEEEEEE--
    psipred: --EE-----EEEEEEE-----EE-----EEEEEE----EEEEEEEE-----EEEEEEE-----EEEEE-----EEEEE-----EEEEEEEE---------EEEEEEEEEEE--
    spider3: --------EEEEEEE-------------EEEEE-----EEEEEEEE------EEEEE------EEEEEE----EEEEE----EEEEEEEEEE----HHHHHHHHHHHHHHH--
   disopred: -----------------------------------------------------------------------------------------------------------------
      tmhmm: -----------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
15559111.00comparative modeling1-1131139 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington