SSGCID - BewuA.18928.a.9 nsp8

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
15667CompleteStructure prediction ssgcidSSGCID - BewuA.18928.a.9 ...1988 Feb 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .   
   sequence: AIASEFSSLPSYAAFATAQEAYEQAVANGDSEVVLKKLKKSLNVAKSEFDRDAAMQRKLEKMADQAMTQMYKQARSEDKRAKVTSAMQTMLFTMLRKLDNDALNNIINNARDGCVPLNIIPLTTAAKLMVVIPDYNTYKNTCDGTTFTYASALWEIQQVVDADSKIVQLSEISMDNSPNLAWPLIVTALRANSAVKLQ
 deepconcnf: --HHH-----HHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--HHHHHHHHHHHH---EEEEEEE-----EEEEEE--HHHHHHH----EEEEEEEEEEEEEEE-----EEEEEE------------EEEEEEEE---EE--
    psipred: --HHHH----HHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH--EEEEEEEHHH----EEEEE--HHHHHHHEE--EEEEEEEEEEEEEEE-----EEEEEEEE----------EEEEEEEE---EE--
    spider3: HHHHHH---HHHHHHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHHHHH--HHHHHHHHHHH----EEHHHHHHHH---EEEEE--HHHHHHEEE--EEEE--EEEEEEEEE-----EEEEEEE----------EEEEEEEE--------
   disopred: DDD----------------DDDDDDDDDDDDDDDDDDD----------------------------------DDDDDD--D---------------------------------------------------------------------------------------------------------------------
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
15560110.94comparative modeling1-1981989 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington