SSGCID - BewuA.20418.a ORF7a

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
15657CompleteStructure prediction ssgcidSSGCID - BewuA.20418.a OR...1218 Feb 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120 
   sequence: MKIILFLALITLATCELYHYQECVRGTTVLLKEPCSSGTYEGNSPFHPLADNKFALTCFSTQFAFACPDGVKHVYQLRARSVSPKLFIRQEEVQELYSPIFLIVAAIVFITLCFTLKRKTE
 deepconcnf: -HHHHHHHHHHHHHHHHHH--------EEEE---------------------EEEEEE--EEEEEE-----EEEEEEEEEE--------HHHHHHHHHHHHHHHHHHHHHHHHHHH-----
    psipred: -EEEEEEHHHHHHHHHHHHHHHHH---EEEE----------------------EEEEEE--EEEEE------EEEEEE-----HHH---HHHHHHH---HHHHHHHHHHHHHHHEEE----
    spider3: --HHHHHHHHHHHHHHHHHHHHH----EEEE----------------------EEEEE---EEEEE-----EEEEEEEEEEE-------HHHHHHH--HHHHHHHHHHHHHHHHHHH----
   disopred: -----------------------------------DDDDDDDDD--------------------------------------------------------------------------DDD
      tmhmm: ------------------------------------------------------------------------------------------------TTTTTTTTTTTTTTTTTTTT-----
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
15550110.71comparative modeling1-1211219 Feb 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington