2018-05-05_00000000_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
143CompleteStructure predictionrobetta_beta2018-05-05_00000000_1_191005 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100
   sequence: GPSQPKVPEWVNTPSTCCLKYYEKVLPRRLVVGYRKALNCHLPAIIFVTKRNREVCTNPNDDWVQEYIKDPNLPLLPTRNLSTVKIITAKNGQPQLLNSQ
 deepconcnf: --------------HHHHHHHH--------EEEEE--------EEEEEE----EEEE----HHHHHHHH-------------------------------
    psipred: ---------------------------HHHH-------------EEEEE----EEE----HHHHHHHHHHHH----------EE----------------
    spider3: -------------------EEE-----HHHEEEEEE-------EEEEEE----EEEE----HHHHHHHH--------------EEE--------------
   disopred: DDDDDDDDDDD---------------------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD
      tmhmm: ----------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
217110.59comparative modeling1-1001005 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington