T0953s1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
142CompleteStructure predictioncaspT0953s1724 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70  
   sequence: GALGSASIAIGDNDTGLRWGGDGIVQIVANNAIVGGWNSTDIFTEAGKHITSNGNLNQWGGGAIYCRDLNVS
 deepconcnf: ------EEEE--------------HHHH----EEEEE---EEEE------------------------EEE-
    psipred: ------EEEE------EEE----HHHHH----EEEEE----EEEE--EE------EEEE-----EEEEEEE-
    spider3: ------EEEEE------EE-----EEEEE--EEEEEE---EEEEE---EEEE---EE-----------EE--
   disopred: DDD---------------------------------------------------------------------
      tmhmm: ------------------------------------------------------------------------
| | View
Powered by 3Dmol.js


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
209110.06comparative modeling1-72724 May 2018
21012n/aab initio1-72724 May 2018



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington