T0953s2

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
141CompleteStructure predictioncaspT0953s22494 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .    
   sequence: MAVQGPWVGSSYVAETGQNWASLAANELRVTERPFWISSFIGRSKEEIWEWTGENHSFNKDWLIGELRNRGGTPVVINIRAHQVSYTPGAPLFEFPGDLPNAYITLNIYADIYGRGGTGGVAYLGGNPGGDCIHNWIGNRLRINNQGWICGGGGGGGGFRVGHTEAGGGGGRPLGAGGVSSLNLNGDNATLGAPGRGYQLGNDYAGNGGDVGNPGSASSAEMGGGAAGRAVVGTSPQWINVGNIAGSWL
    psipred: -EE--------EEE----------EEEEEEEE----EEEE-----EEEEEEEE------HHHHHHH-------EEEEEE--EEE--------EEE-------EEEEEE--EEEE-----------------EEE-----EEEEE---EEE----------------------------------EEEE----------------------------------------EEEE---EEE----EEEEEE-
   disopred: DDDD-----------D------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDDDDDD---------------------------
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Predicted Domains

Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
211110.34comparative modeling1-50505 May 2018
212210.41comparative modeling45-1471035 May 2018
213310.11comparative modeling144-2491065 May 2018
21632n/aab initio144-2491065 May 2018



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington