SSGCID - MygeA.18852.a 30S ribosomal protein S14 type Z MG_164

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
14032CompleteStructure predictionssgcidSSGCID - MygeA.18852.a 30...6115 Jan 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60 
   sequence: MAKKSLKVKQSRPNKFSVRDYTRCLRCGRARAVLSHFGVCRLCFRELAYAGAIPGVKKASW
    psipred: --HHHHHHHH--------------------HHH-----HHHHHHHHHHH------EE----
    spider3: ---HHHHHH-----------E---------HHHHHHH-HHHHHHHHHHH-------EE---
 deepconcnf: --HHHHHHH---------------------HHHHHHH---HHHHHHHHH------EEE---
   disopred: D----------------------------------------------------------DD
      tmhmm: -------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14471110.81comparative modeling1-616123 Jan 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington