T0951

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
140CompleteStructure predictioncaspT09512763 May 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    . 
   sequence: GPLGSMSSIGLAHNVTILGSGETTVVLGHGYGTDQSVWKLLVPYLVDDYKVLLYDHMGAGTTNPDYFDFDRYSSLEGYSYDLIAILEEFQVSKCIYVGHSMSSMAAAVASIFRPDLFHKLVMISPTPRLINTEEYYGGFEQKVMDETLRSLDENFKSLSLGTAPLLLACDLESAAMQEYCRTLFNMRPDIACCITRMICGLDLRPYLGHVTVPCHIIQSSNDIMVPVAVGEYLRKNLGGPSVVEVMPTEGHLPHLSMPEVTIPVVLRHIRQDITDH
 deepconcnf: ----------EE--EEEE-----EEEEE------HHHHH---------EEEEEE--------------------HHHHHHHHHHHHHH----EEEEEEE-HHHHHHHHHHHH----EEEEEEE-----------------HHHHHHHHHHHHHHHHHHHH-HHHHH------HHHHHHHHHHHH---HHHHHHHHHHHH--------------EEEEEE-------HHHHHHHHHH-----EEEEE------HHHH-HHHHHHHHHHHHHHH----
    psipred: --------HHHH--EEEE-----EEEEE------HHHHHHHHHHH----EEEEE--------------------HHHHHHHHHHHHHH-----EEEEEE-HHHHHHHHHHHH-HHHHHHEEEE-----------------HHHHHHHHHHHHHHHHHHHHHHHHHH------HHHHHHHHHHHH---HHHHHHHHHHHH---HHHHH------EEEEE--------HHHHHHHHHH-----EEEEE------HHH--HHHHHHHHHHHHHH-----
    spider3: -------HHHHH--EEEE-----EEEEE------HHHHHHHHHHH----EEEEE--------------HHH---HHHHHHHHHHHHHH-----EEEEEE-HHHHHHHHHHHH-HHHEEEEEEE-----------------HHHHHHHHHHHHH-HHHHHHHHHHHHH-----HHHHHHHHHHHH---HHHHHHHHHHHH----HHHH------EEEEE--------HHHHHHHHHH-----EEEEE-----------HHHHHHHHHHHHHH-----
   disopred: DDDDDDDDDDD-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D---DDDD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
208110.95comparative modeling1-2762763 May 2018



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington