SSGCID - MygeA.17937.a 30S ribosomal protein S8 MG_165

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
13990CompleteStructure predictionssgcidSSGCID - MygeA.17937.a 30...14115 Jan 2020-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140 
   sequence: MIINKVPKAHFDPVSDLFTKINNARKAKLLTVTTIASKLKIAILEILIKEGYLANYQVLENKTKTKKLVSFTLKYTQRRICSINGVKQISKPGLRIYRSFEKLPLVLNGLGIAIISTSDGVMTDKVARLKKIGGEILAYVW
    psipred: ------------HHHHHHHHHHHHHH----EEE--HHHHHHHHHHHHHH------EEEEE-------EEEEEEEE-----------EE------EEE-------------EEEEEE-------HHHHHH-----EEEEEE-
    spider3: ------------HHHHHHHHHHHHHH----EEEE---HHHHHHHHHHHH-----EEEEEE-------EEEEEEEE-----E-EEEEEEE-----EEE--HHH---E---EEEEEEE-------HHHHHH-----EEEEEE-
 deepconcnf: ------------HHHHHHHHHHHHHH----EEEE---HHHHHHHHHHHH---EEEEEEEE-----EEEEEEEEEE----EEEEEEEEEE----EEEEE------------EEEEEE-------HHHHHH-----EEEEEE-
   disopred: DDDDD----------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14205110.91comparative modeling1-14114119 Jan 2020



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington