MR25 fosto

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
13902CompleteStructure prediction MarcoMR25 fosto19214 Jan 202014 Feb 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190  
   sequence: TGDNHLGYYEKNLTLKDDCYKLFEQYLKEATQKEGSILLQCGDLFNDLRPNKSCVSKTANLIKKYCIGDADIPYTIKDEAELSYPLNITDPYINVKHPLFTIHGTNDEPSGYKLIAGSEILASCGLVNYISPKSFEEEKMLKPVIIVNEHTKIALYGLSVLYSSDLDEIVEDETFHIKKPNGNDWICILLLY
    psipred: --------------HHHHHHHHHHHHHHHHHH----EEEE-----------HHHHHHHHHHHHHHH-------EEEE---------------------EEEEE---------------HHH-----EEEE--------EEEEEEEEE---EEEEEE------HHHHHHHHHH---EE--------EEEEEE-
    spider3: HHHH--------HHHHHHHHHHHHHHHHHHHHH---EEEEE----------HHHHHHHHHHHHHHH-------EEE----------------------EEEE--------------HHHHHHH---EEEE------HHEEEEEEEEE---EEEEEEEE----HHHHHHHHH---EEE--------EEEEEEE
 deepconcnf: ------------HHHHHHHHHHHHHHHHHHHH----EEEEE----------HHHHHHHHHHHHHHH-------EEEEE-----EE-------------EEEEE-------HHHHHHHHHHHHH---EEEE--------EEEEEEEEEE--EEEEEEEEE------HHHHHHH-EEEEE-------EEEEEE-
   disopred: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
13918110.99comparative modeling1-19219214 Jan 2020



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington