CC-Di-B3Linker 5ECoR1Na3M4A

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
13894CompleteStructure prediction 848997394@qq.comCC-Di-B3Linker 5ECoR1Na3M...27114 Jan 202015 Feb 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270 
   sequence: KIAALKYKNAALKKKIAALKQGALEGSGLKPDLPKLVKLLKSSNEEILLKALRALAEIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQIQAVIDAGALPALVQLLSSPNEQILQEALWALSNIASGGNEQKQAVKEAGALEKLEQLQSHENEKIQKEAQEALEKLQSH
 deepconcnf: -HHHHHHHHHHHHHHHHHH-------------HHHHHHHHH---HHHHHHHHHHHHHHH----HHHHHHHH--HHHHHHHHH----HHHHHHHHHHHHHHH---HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHH---HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHH---HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHH---HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHH--
    psipred: -HHHHHHHHHHHHHHHH--------HHHH--HHHHHHHHH----HHHHHHHHHHHHHH-----HHHHHHHH---HHHHHHHH------HHHHHHHHHHHH----HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHH------HHHHHHHHH---HHHHHHHH-------HHHHHHHHHHHH---HHHHHHHHH---HHHHHHHH------HHHHHHHHHHHHHH--HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHH--
    spider3: HHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHHH----HHHHHHHHHHHHHHH----HHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHH---HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHH---HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHHH--HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHHH--HHHHHHHHH---HHHHHHHH----HHHHHHHHHHHHHHH--
   disopred: DD----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
14003110.86comparative modeling1-27127116 Jan 2020



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington