2018-04-28_00000085_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
136CompleteStructure predictionrobetta_beta2018-04-28_00000085_1_1958828 Apr 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420    .  430    .  440    .  450    .  460    .  470    .  480    .  490    .  500    .  510    .  520    .  530    .  540    .  550    .  560    .  570    .  580    .   
   sequence: MGGTARGPGRKDAGPPGAGLPPQQRRLGDGVYDTFMMIDETKCPPCSNVLCNPSEPPPPRRLNMTTEQFTGDHTQHFLDGGEMKVEQLFQEFGNRKSNTIQSDGISDSEKCSPTVSQGKSSDCLNTVKSNSSSKAPKVVPLTPEQALKQYKHHLTAYEKLEIINYPEIYFVGPNAKKRHGVIGGPNNGGYDDADGAYIHVPRDHLAYRYEVLKIIGKGSFGQVARVYDHKLRQYVALKMVRNEKRFHRQAAEEIRILEHLKKQDKTGSMNVIHMLESFTFRNHVCMAFELLSIDLYELIKKNKFQGFSVQLVRKFAQSILQSLDALHKNKIIHCDLKPENILLKHHGRSSTKVIDFGSSCFEYQKLYTYIQSRFYRAPEIILGSRYSTPIDIWSFGCILAELLTGQPLFPGEDEGDQLACMMELLGMPPPKLLEQSKRAKYFINSKGIPRYCSVTTQADGRVVLVGGRSRRGKKRGPPGSKDWGTALKGCDDYLFIEFLKRCLHWDPSARLTPAQALRHPWISKSVPRPLTTIDKVSGKRVVNPASAFQGLGSKLPPVVGIANKLKANLMSETNGSIPLCSVLPKLIS
    psipred: ---------------------HHHHH-----EEEEEEE---------------------------HHH-----EEEE-------HHHHHHHH----------------------------HHHHHH----------------HHHHHHHHHHHHHHHHHHHH----EEEEE-------EEEEE------------EEEEE-HHHHHHHHHHHH-------EEEEEEE-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH-------HHHHHHHHHHHHHHHHHHHH--EEE-EEEHHHEEE--------EEEE----HHHHHHHHHHHHHH----HHHHH------HHHHHHHHHHHHHHHH----------HHHHHHHHHH-----HHHHHHHHHHHHHHH------EEEEEE----EEEEEE----------------HHHHH----HHHHHHHHHHHH---------HHHHHH---HH---------EE-----EEE-HHHHHHHH------HHHHHHHHHHHHHHH------HHHHHHHH--
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDD---------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD------------------------------DDDDDDDDDDDDDDD-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDDD--DDD------------------DDDDDDDDDDDDDDDDDD----------------------------------------------DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-------------
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Predicted Domains

Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
198110.05comparative modeling1-10510529 Apr 2018
199210.25comparative modeling101-1676729 Apr 2018
200310.72comparative modeling163-58842629 Apr 2018
20112n/aab initio1-10510529 Apr 2018



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington