2018-04-28_00000062_1_19

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
126CompleteStructure predictionrobetta_beta2018-04-28_00000062_1_1932928 Apr 2018-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .    
   sequence: EVYDVTIIGGGPIGLFTAFYCGMRELKTKVIEFLPKLGGKVSLFFPEKIIRDIGGIPGIAGKQLIEQLKEQAATFDPDIVLNQRVTGFERLDDGTIVLTGSEGKKHYTRTVILACGMGTLEVNEFDSEDAARYAGKNLHYGVEKLDAFKGKRVVISGGGDTAVDWANELEPIAASVTVVHRREEFGGMESSVTKMKQSSVRVLTPYRLEQLNGDEEGIKSVTVCHTESGQRKDIEIDELIINHGFKIDLGPMMEWGLEIEEGRVKADRHMRTNLPGVFVAGDAAFYESKLRLIAGGFTEGPTAVNSAKAYLDPKAENMAMYSTHHKKLV
    psipred: ----EEEE---HHHHHHHHHHHH----EEEEE-------EEEE-----EEEE--------HHHHHHHHHHHHHH---EEEE--EEEEEEE-----EEEEE----EEE--EEEEE-------EEE-----HHHH----EEEEE--HHHH---EEEEE---HHHHHHHHHHHHH--EEEEEEE-------HHHHHHHH----EEEE--EEEEEEE---EEEEEEEEE-----EEEEE--EEEEEE------HHHHH--EE----EEEE----------EEEEEE-------EEEEEEHHHHHHHHHHHHHHHHHH-----------HHH--
    spider3: --EEEEEE---HHHHHHHHHHHH----EEEEE-------HHHHH-----EEE--------HHHHHHHHHHHHHHH--EEEE--EEEEEEEE----EEEE-----EEEE-EEEEEE--------------HHHH----EEEE---HHHH---EEEEE---HHHHHHHHHHH----EEEEEE--------HHHHHHHHH---EEEE--EEEEEE-----EEEEEEEE-----EEEEE--EEEEEE------HHHHH---EEE--EEEE-----E----EEEEEEEE-----HHEHHHHHHHHHHHHHHHHHHHHHHHH-------------
 deepconcnf: ---EEEEE---HHHHHHHHHHHH---EEEEEE----------------------------HHHHHHHHHHHHHH---EEEE--EEEEEEE----EEEEEE----EEEEEEEEEE-------EEE--------------EEE----------EEEEE---HHHHHHHHHH-----EEEEEEE-------HHHHHHHHH---EEE---EEEEEEE----EEEEEEEE-----EEEEE--EEEE----------------EEE--EEEE----------EEEE---------HHHHHHHHHHHHHHHHHHHHHH------------------
   disopred: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD-DDDDDDDDDDDDDD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
179110.59comparative modeling1-32932928 Apr 2018



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington