EHEE4

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
11921CompleteStructure prediction Dmitri.Kapitonov@hsc.utah.eduEHEE4392 Dec 20193 Jan 2020
             1   .   10    .   20    .   30    .    
   sequence: MDCDIRSQSCHVRTDRPNECERICKECKKRGYEVHCDNR
 deepconcnf: ----------EE-------HHHHHHHHHH---EEE----
    psipred: ----------EE------HHHHHHHHHHH---EEE----
    spider3: ------------------HHHHHHHHHH-----------
   disopred: DDD-DDDD---DD-------------------D-D-DDD
      tmhmm: ---------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
12003110.44comparative modeling1-39393 Dec 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington