1j0w.pdb

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
11918CompleteStructure prediction 54thdevilspl1j0w.pdb952 Dec 20192 Jan 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .
   sequence: GGEFPVQDLKTGEGGLLQVTLEGINLKFMHNQERKVFIELNHIKKCNTVRGVFVLEEFVPEIKEVVSHKYKTPMAHEICYSVLCLFSYVAAVHSS
   disopred: D-------------------------------------------------------------------------------------------DDD
      tmhmm: -----------------------------------------------------------------------------------------------
| Download | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
1197811n/acomparative modeling1-95953 Dec 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington