Test 1

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
11913Domain parse completeStructure prediction acphTest 1382 Dec 20192 Jan 2020
             1   .   10    .   20    .   30    .   
   sequence: MLRSDACHQRSTCVEKMLTVDCMIGCEDSGVCYVSGRD
   disopred: DDDDDDDDD---------------------------DD
      tmhmm: --------------------------------------
Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
-110.19comparative modeling1-3838-
-12n/aab initio1-3838-



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington