Test 1
Job ID | Status | Method | Username | Target | Length | Date (PST) | Expiration Date (PST) |
11913 | Domain parse complete | Structure prediction | acph | Test 1 | 38 | 2 Dec 2019 | 2 Jan 2020 |
1 . 10 . 20 . 30 .
sequence: MLRSDACHQRSTCVEKMLTVDCMIGCEDSGVCYVSGRD
disopred: DDDDDDDDD---------------------------DD
tmhmm: --------------------------------------
Domain ID | Domain | Parse | Confidence | Modeling Method | Model Span | Length | Date (PST) |
- | 1 | 1 | 0.19 | comparative modeling | 1-38 | 38 | - |
- | 1 | 2 | n/a | ab initio | 1-38 | 38 | - |
http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington