test10

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
11912CompleteStructure prediction fjaumauxtest10482 Dec 20193 Jan 2020
             1   .   10    .   20    .   30    .   40    .   
   sequence: MLAFLKLVAKLGPKAAKWAWANKSRVLGWIRDGMAIEWIINKINDIVN
    psipred: -HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHHHHHHHH--
    spider3: -HHHHHHHHHHHHHHHHHHHH-HHHHHHHHH----HHHHHHHHHHH--
 deepconcnf: -HHHHHHHHHHHHHHHHHHHH-HHHHHHHHH----HHHHHHHHHHHH-
   disopred: DD----------------------------------------------
      tmhmm: ------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
12001110.99comparative modeling1-48483 Dec 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington