Signal Peptidase

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
11905CompleteStructure predictionYanBorlaSignal Peptidase1802 Dec 20194 Jan 2020
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180
   sequence: MREHINTLLSLRVRDVIQQVVTVGLFLSIVLVGWRAVAVGTNCEASIVVVLSGSMEPGYYRGDVLLLHHRPEYPVTVGDIIVYTLPGQEIPIVHRVHRIHQRSEDGKKFYLTKGDNNVNDDRFLFRNGREWVEEGMIIGKTYAYVPRIGYLTIMFNESKIIKYLALGLIGFFLLTTTDEM
    psipred: -HHHHHHHH---HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----EEEEEE-----------EEEEE-----------EEEEE-------EEEEEEEEEEE-----EEEEEE----------HHH-------HHHEEEEEEEEE---HHHHHHH---HHHHHHHHHHHHHHEEEE----
    spider3: -HHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHHHHHHHH------EEEE------------EEEEE-----------EEEEE-------EEEEEEEEEEE-----EEEEE--------HHHH---------HHHEEEEEEEEE---HHHHHHH--HHHHHHHHHHHHHHHHHH-----
 deepconcnf: --HHHHHH----HHHHHHHHHHHHHHHHHHHHHHHHHHHHH-----EEEEEE-----------EEEEE-----------EEEEE-------EEEEEEEEEEE-----EEEEE-----------HH-----------EEEEEEEE---HHHHHHHH---HHHHHHHHHHHHHHHHHH----
   disopred: DD-DDD----------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD
      tmhmm: --------------TTTTTTTTTTTTTTTTTTTTTTT--------------------------------------------------------------------------------------------------------------------------TTTTTTTTTTTTTTTTTT---
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
12002110.37comparative modeling1-1801803 Dec 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington