DnaC

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
11144ExpiredStructure prediction kettnerDnaC24515 Nov 201916 Dec 2019
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .
   sequence: MKNVGDLMQRLQKMMPAHIKPAFKTGEELLAWQKEQGAIRSAALERENRAMKMQRTFNRSGIRPLHQNCSFENYRVECEGQMNALSKARQYVEEFDGNIASFIFSGKPGTGKNHLAAAICNELLLRGKSVLIITVADIMSAMKDTFRNSGTSEEQLLNDLSNVDLLVIDEIGVQTESKYEKVIINQIVDRRSSSKRPTGMLTNSNMEEMTKLLGERVMDRMRLGNSLWVIFNWDSYRSRVTGKEY
 deepconcnf: ---HHHHHHHHHHH----------------HHHHH----------HHHHHHHHHHHHHH-------------------HHHHHHHHHHHHHHHH------EEEEEE-----HHHHHHHHHHHHHH----EEEEEHHHHHHHHHHHH------HHHHHHHH----EEEEE--------HHHHHHHHHHHHHHH-----EEEE----HHHHHHHHHHHHHHHHH---EEEEEE--------------
    psipred: -HHHHHHHHHHHH------------------EEE-------------HHHHHHHHHHHH----HHHHH----------HHHHHHHHHHHHHHHH------EEEEE------HHHHHHHHHHHHHH---EEEEEEHHHHHHHHHHHH------HHHHHHHH----EEEEE--------HHHHHHHHHHHHHHHH----EEEE----HHHHHHH--HHHHHH------EEEEEE---HHHHHHH---
    spider3: ---HHHHHHHHHHH------------------HHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHH-----------HHHHHHHHHHHHHHHH-------EEEE------HHHHHHHHHHHHHH----EEEEEHHHHHHHHHHH-------HHHHHHHHH---EEEEE--------HHHHHHHHHHHHHHHH----EEEEE---HHHHHHHH-HHHHHHHH----EEEEE----HHH-------
   disopred: DDDDDDDDDDDDDDDDDD--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DD--DDDDD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
11188110.95comparative modeling1-24524515 Nov 2019



http://www.bakerlab.org | Contact | Terms of Service
©2020 University of Washington