P. falciparum Kinase

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
11114CompleteStructure prediction pcravoP. falciparum Kinase35314 Nov 201916 Dec 2019 (23:12:10)
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350   
   sequence: MNDSISSPIKATCRDMALKSSLHSFTFSLKDFDIAGFLGDGAHGSVFLACERRTNFICVLKCISKSHLVKSTQEALLRKEIELQAHLKHPHIACMYTWFHTSSHVFFVMEYCSNGDLFTYLNENGPFCEKKVAEMLFEIIWAIRTCHDKRIAHLDLKPENVLVNHEEKCKLADFGLSAHIGSKHKKKGISHYRGTHDYWSPEQCARHQKKKQNFGEFDQKTDIWTLGILAFELKFGRPPFGSTNEERENVIMNRIQDYHWSQLFCEKVKQDLIDKLSPEFKDFLNLCLDKNPKKRPTAESLIQHPFIFIHNKNRSCIKSYATQPRGKQGPKLSHKGFNEQDGSFLTPIWFHNK
    spider3: ------------HHHHHH----------HHHEEEEEEEE----EEEEEEEE-----EEEEEEEEHHH-----HHHHHHHHHHHHHH-----EEEEEEEEEE--EEEEEEEE-----HHHHHHHH----HHHHHHHHHHHHHHHHHHHH---------HHHEEE-----EEEE---EEEE------------EE--HHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHH---------HHHHHHHHHHHH---HHHHHHHH----------HHHHHHHHHH----HHH---HHHHH--HHHHH--------------------------------------------
 deepconcnf: -------------------------------EEEEEEEEE---EEEEEEEE-----EEEEEEEE------HHHHHHHHHHHHHHH--------EEEEEEE---EEEEEE-------HHHHHHHH----HHHHHHHHHHHHHHHHHHHH------------EEE-----EEE-------------------EEE-------HHHHH-------------HHHHHHHHHHHHHHHHH---------HHHHHHHHHHHH----HHHHHHHHHHHHH----HHHHHHHHHH----------HHHHH---HHHHHHHHHHH-------------------------------------
    psipred: -------------HHH------------HHHEEEEEEEEE----EEEEEEE-----EEEEEEEEHHHHHH--HHHHHHHHHHHHHH--------EEEEEEE--EEEEEEE------HHHHHHHH----HHHHHHHHHHHHHHHHHHHH---------HHHEEE-----EEE------EE---------EEE---------HHHH---------------HHHHHHHHHHHHHHHH----------HHHHHHHHHHH---------------------HHHHHHHHHH----HHH---HHHHHH------------------------------HH------------------
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDD---------------------------------------DDDDD----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDDDDDDDDDDDDDDDDD-------------DDDD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
11165110.58comparative modeling1-35335314 Nov 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington