2019-11-09_00000172_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10843CompleteStructure predictioncameo2019-11-09_00000172_1_112299 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .    
   sequence: SNAADPEVCCFITKILCAHGGRMALDALLQEIALSEPQLCEVLQVAGPDRFVVLETGGEAGITRSVVATTRARVCRRKYCQRPCDNLHLCKLNLLGRCNYSQSERNLCKYSHEVLSEENFKVLKNHELSGLNKEELAVLLLQSDPFFMPEICKSYKGEGRQQICNQQPPCSRLHICDHFTRGNCRFPNCLRSHNLMDRKVLAIMREHGLNPDVVQNIQDICNSKHMQKN
    psipred: -----HHHHHHHHHHHH-----EEHHHHHHHH---HHHHHHHHHH-----EEEEE--------EEEEEE-----------------EE--HHHH----------------------HHHHHHHHH-------HHHHHHHHH---------HHHHH-----------------EEE-HHHHH----------------HHHHHHHHH----HHHHHHHHHHHHHHHHHH-
    spider3: -----HHHHHHHHHHHHH---EEEHHHHHHH----HHHHHHHHHHH---HEEEEE--------EEEEEEE--EE------------EEE-HHHH----------------------HHHHHHHHH-------HHHHHHHHHH-------HHHHH-------------------EE-HHHH-----------------HHHHHHHHH----HHHHHHHHHHHHHHHHH--
 deepconcnf: -----HHHHHHHHHHHHH----E-HHHHHHHH---HHHHHHHHHHH----EEEEE--------EEEEEE-----------------EEE---------------------------HHHHHHHHH-------HHHHHHHHH--------HHH---------------------------------------------HHHHHHHHH----HHHHHHHHHHHHHHHH---
   disopred: DDDDD--DD-------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDD
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10827110.94comparative modeling1-2292299 Nov 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington