2019-11-09_00000127_2_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10829CompleteStructure predictioncameo2019-11-09_00000127_2_11599 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .    
   sequence: GPPQFKPLKISVDPEIPAPPAIADLLASVDSEEVREYCKKKGWIVEVPVTATTLERNVS
    spider3: -------------------HHHHHHHHH---HHHHHHHHH---EE-------EEEEE--
 deepconcnf: --------EEEE-------HHHHHHHH---HHHHHHHHHH---EEE------EEEE---
    psipred: -------------------HHHHHHHHH---HHHHHHHHH--EEEE-----HHHH----
   disopred: DDDDD-----D-----------------------------------------DDDDDDD
      tmhmm: -----------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10805110.61comparative modeling1-59599 Nov 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington