2019-11-09_00000125_2_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10827CompleteStructure predictioncameo2019-11-09_00000125_2_11349 Nov 2019-
             1   .   10    .   20    .   30    
   sequence: GLTIEAEPTELSYQDALEMLAESKPVSTTLSFER
    psipred: ------------HHHHHHHHH------EEEE---
    spider3: ------------HHHHHHHHHH------------
 deepconcnf: --EEEE------HHHHHHHHHH----EEEEEEE-
   disopred: DDDDDD----------------------D-DDDD
      tmhmm: ----------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10804110.35comparative modeling1-34349 Nov 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington