2019-11-09_00000096_2_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10823CompleteStructure predictioncameo2019-11-09_00000096_2_11939 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90   
   sequence: HKIPAEADFLIAYSTAPGYYSYRNTSNGSWFIQSLCEVLNKYGSELEIMEILTRVNHKVSLRSESSSNDPAFNGKKQMPCFASMLTKKLYFSP
 deepconcnf: --------EEEEE-----EEEEE-----HHHHHHHHHHHHHH-----HHHHHHHHHHHHHHHHH-----------------------EEE---
    psipred: --------EEEEEE----EEEEE-------HHHHHHHHHHHH----HHHHHHHHHHHHHHHHH------------EE-----EEEEEEEEE--
    spider3: --------EEEEE------EEEE------HHHHHHHHHHHHH-----HHHHHHHHHHHHHHH--------------E--EEEEEE--EEE---
   disopred: ---------------------------------------------------------------------------------------------
      tmhmm: ---------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10801110.92comparative modeling1-93939 Nov 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington