2019-11-09_00000096_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10821CompleteStructure predictioncameo2019-11-09_00000096_1_111429 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140  
   sequence: LDNSYKMNHKRRGLCLIINNKNFDRKTGMKTRNGTDKDAENLEKTFKSLGFEVKVYNDLTAEEMQETLQEVSKEDHSDSDCFVCVLLSHGEEGLVYGTDGKIEIQELTSLFKGDKCQSLVGKPKLFFIQACRGDELDSGVEV
    spider3: -------------EEEEEE---------------HHHHHHHHHHHHHH---EEEEEE---HHHHHHHHHHHHH-------EEEEEEEE-----EEEEE---E-HHHHHH-------HHH----EEEEEEE------------
 deepconcnf: ------------EEEEEEE----------------HHHHHHHHHHHHH---EEEEE----HHHHHHHHHHHH--------EEEEEEEEE----EEEEE--EEEHHHHH---------------EEEEEE----------EE-
    psipred: -------------EEEEE----------------HHHHHHHHHHHHHH---EEEEE----HHHHHHHHHHHHHHH-----EEEEEE-------EEEEE---EEHHHHHH---------------EEEEE----------EE-
   disopred: ------------------------------------------------------------------------------------------------------------------------------------------D---
      tmhmm: ----------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10799110.99comparative modeling1-1421429 Nov 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington