2019-11-09_00000048_1_11

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10808CompleteStructure predictioncameo2019-11-09_00000048_1_111199 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .    
   sequence: GNNEYKKGLWTVEEDKILMDYVKAHGKGHWNRIAKKTGLKRCGKSCRLRWMNYLSPNVKRGNFTEQEEDLIIRLHKLLGNRWSLIAKRVPGRTDNQVKNYWNTHLSKKLGIKDQKTKQS
 deepconcnf: -----------HHHHHHHHHHHHHH-------HHHHH-----------HHHHHH-HHHH-----HHHHHHHHHHHHHH--HHHHHHH------HHHHHHHHHHHHHHHH----------
    psipred: -----------HHHHHHHHHHHHHH----HHHHHHHHHHHH----HHHHHHHH-----------HHHHHHHHHHHHHH--HHHHHHHH-----HHHHHHHHHHHHHHH-----------
    spider3: -----------HHHHHHHHHHHHHH----HHHHHHH---HH--HHHHHHHHHH-----------HHHHHHHHHHHHHH-HHHHHHHH------HHHHHHHHHHHHHHH-----------
   disopred: DD-------------------------------------------------------------------------------------------------------------DDDDDDDD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10779110.35comparative modeling1-1191199 Nov 2019



http://www.bakerlab.org | Contact | Terms of Service
©2019 University of Washington