SSGCID - MygeA.10014.c Putative ABC transporter ATP-binding protein MG468.1 MG_526

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10550CompleteStructure predictionssgcidSSGCID - MygeA.10014.c Pu...2844 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    
   sequence: MVLKTKENKKFDIYLKSSDFAVSKKASKLIKKLNKKHPKRKSLNSFEAKKYDIYFKEVCKAVTNGINNQLICNHINLKILPGEFVVILGKSGSGKTSLLSLISALDRPTSGDSFVCGTNTICCSDAKLTALRNKNVGYIFQQYGLLRDLDVDDNIKLALPLKKRFNNNLEELLERLELKEHRHKKVHKLSGGQQQRVAIARALIKEPKILFGDEPTGAVNIDISKKILQFFVEYNRDKGTTIVIVTHNEKIVELAKRVIKIHDGKIIVDYLNQNPKTIEQINWV
    psipred: -EEE-----EEEEEE----EE--HHHHHHHHHHH-----------------EEEEEEEEEEE-----EEEEEEEEEEEEE---EEEEE----HHHHHHHHHHH-------EEEEE--EE-----HHHHHHHHH--EEEE-----------HHHHHHHHH----HHHHHHHHHHHH---HHHH---HHH--HHHHHHHHHHHHHHH---EEEEE-------HHHHHHHHHHHHHHHHH---EEEEE---HHHHHH--EEEEEE--EEEEEE-------HHH----
   disopred: DDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD-----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------DDD----
      tmhmm: --------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Predicted Domains

Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
15802110.48comparative modeling1-515112 Feb 2020
10932210.85comparative modeling45-28424010 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington