SSGCID - MygeA.20034.a Probable ribosome biogenesis GTPase A MG_442

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10546CompleteStructure predictionssgcidSSGCID - MygeA.20034.a Pr...2704 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270
   sequence: MDTYTSAKINWFPGHMKKIHDQLKKLSSQIDGIIEIVDARAPTLTHNSEIISYFLNKPKLILALKTDLAQYKPNKKILFGSLKEPFKLKKKVLKTLTTLFANKRQQLKAKGLLIKQFRLAVIGMPNVGKSSLINLLINKNHLKVANRAGITKSLNWIQISPELLLSDTPGVFLKRIDEIQIGYKLVLTNVIRREVVNIEEVGMFAFNYLKKHYKQLLPFEADSFINFLEKFAKVRGLIKKANELNTNLACEIFINELINGKYGKLSYELN
 deepconcnf: --------------HHHHHHHHHHHH-----EEEEEE----------HHHHHHH-----EEEEEE---------HHHHHHH--------HHHHHHHHHHHHHHHHHHHH-------EEEEEEE-----HHHHHHHHH------------------EEEE---EEEEE----------HHHHHHHHHHH---------HHHHHHHHHHHHHHH-----------HHHHHHHHHHH----E------HHHHHHHHHHHHH-----EEEE---
    psipred: -------EEEE--HHHHHHHHHHHH------EEEEEEE----------HHHHHHH----EEEEE------HHHHHHHHHHHHHH----HHHHHHHHHHHHHHHHHHHHH--------EEEEE------HHHHHHHHH------------------EEE----EEEE------------HHHHHHHHHH-EEHHH---HHHHHHHHHHHHHHH-HHHHHH----HHHHHHHHHHH-----------HHHHHHHHHHHHH------EE----
    spider3: --------------HHHHHHHHHHHHHH---EEEEEE-----HHH--HHHHHHHH----EEEEEE-----HHHHHHHHHHHHH------HHHHHHHHHHHHHHHHHHHH--------EEEEE------HHHHHHHHH-----EE-------HHHEEEEE---EEEEE-----------HHHHHHHHHH----HHH--HHHHHHHHHHHHHHH-HHHHHH----HHHHHHHHHHH-----------HHHHHHHHHHHHH------------
   disopred: DD-------------------------------------------------------------------------------------DDD-DD---------------D-----------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10931110.85comparative modeling1-27027010 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington