SSGCID - MygeA.20010.a 5-formyltetrahydrofolate cyclo-ligase MG_245

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10544CompleteStructure predictionssgcidSSGCID - MygeA.20010.a 5-...1654 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .
   sequence: MVDKNSLRKLMLLKRAELNDLEKSHLDQKINQKLMAFLITRPTIKNLALYIPIKNEVAFLDNFLDFLKLNKITSCFPSIVDQFNMKFIDQNNNEINPNDIDCFFIPLLAFNKANHRIGFGKGYYDRYLSLTSKKQLKIGIAYDFQYAEFTNDPWDYQLDLIICNG
    psipred: ---HHHHHHHHHHHHH---HHHHHHHHHHHHHHHH--HHHHHH--EEEEE--------HHHHHHHHHHH---EEEEEEE----EEEEEEEE----------EEE---EEE-----------------HHH------EEEEEHHHEEEE-----------EEE---
    spider3: ---HHHHHHHHHHHHH---HHHHHHHHHHHHHHHH----------EEEEEE-------HHHHHHHHHH----EEEEEEE-----EEEEEE------HHH--EEEE-EEEE-----E-----HHHHHHHHH------EEEEEEHHEEEEE----------EEEE--
 deepconcnf: ---HHHHHHHHHHHHH---HHHHHHHHHHHHHHHH----------EEEEEEE------HHHHHHHHHH---EEEEEEEEE----EEEEEEE----------EEEE---EE-----EE-----HHHHHHHH-----EEEEEEE--EEEEE----------EEEE--
   disopred: DD-------------------------------------------------------------------------------------------------------------------------------------------------------------------
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10930110.96comparative modeling1-16516510 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington