SSGCID - MygeA.20075.a Ribosomal RNA small subunit methyltransferase G MG_380

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10535CompleteStructure predictionssgcidSSGCID - MygeA.20075.a Ri...1924 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190  
   sequence: MNNANFEKYVDLVFEANKNFNLTGFKTKEAIYQNLVIEILTLFKGYEKFFIDKTVADLGSGNGSPGIILKLLFQKIKKLVLIDSKHKKISFLNKLTKQLNLEKTVAICERIEVHKNHYDVICSRGLSTIIKVNDLAFSLLNSKGIIFHIKQSLDQYIEFEKSNQKNQFNLLFIKHFTSQNKKLILIALQKND
 deepconcnf: --HHHHHHHHHHHHHHHHH--------HHHHHHHHHHHHHH------------EEEEE--------HHHHHH-----EEEEEE--HHHHHHHHHHHHHH----EEEEE-----------EEEEE----HHHHHHHH---EEEEEEEEEE-----HHHHHHHHHHHHHHHH---EEEEEEEEEEEEEEEE---
    psipred: -HHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHHHHHHH------EEEEE----------HHHH-----EEEEEE---HHHHHHHHHHHH------EEEE-HHHHHHH---EEEHHHH---HHHHHHHH--EEE--EEEEE-------HHHHHHHHHHHHHHH--EEEEEEEEEEEEEEEE---
    spider3: --HHHHHHHHHHHHHHHH---------HHHHHHHHHHHHHHHHHHHHHH----EEEEE-------HHHHHHH------EEEEE---HHHHHHHHHHHH------EEEE--HHHH-----EEEEHH---HHHHHHHHHHH-EE-EEEEEE-----HHHHHHHHHHHHHHHH---EEEEEEEEEEEEEEEE---
   disopred: D----------------------------------------------------------------------------------------------------------------------------------------------------------DD---------------------------------DD
      tmhmm: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10924110.91comparative modeling1-19219210 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington