SSGCID - MygeA.18443.a Transcriptional regulator MraZ MG_221

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10533CompleteStructure predictionssgcidSSGCID - MygeA.18443.a Tr...1414 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140 
   sequence: MLLGTFNLTLDNKNRISLPAKLRSFFDSSIVINRGFENCLEIRKPADFESYFQTFNNFPNTQKDTRTLKRLIFANANLVELDSANRILIPNNLISDAKLDKEIVLIGQFDHLEVWDKVQYEQYLASSESLETVAERMKDAK
    psipred: ---------------EEE-HHHHHHH---EEEE-------EE--HHHHHHHHHHHHH-----HHHHHHHHHHH---EE-------EEE--HHHHHHH-----EEEEE---EEEEE-HHHHHHHHHHH--HHHHHHHHH---
    spider3: ----EEEEEE-----EEE-HHHHHHHH--EEEE------EEEE-HHHHHHHHHHHH------HHHHHHHHHHH---EEEEE-----E---HHHHHH------EEEE----EEEEE-HHHHHHHHHH---HHHHHHHHHH--
 deepconcnf: -EEEEEEEE------EE--HHHH------EEEEEE---EEEEE-HHHHHHHHHHHH------HHHHHHHHHHH---EEEEE-----EEE-HHHHHH-----EEEEEE---EEEEE-HHHHHHHHH----HHHHHHHHHH--
   disopred: ------------------------------------------------------------------------------------------------------------------------------------------DDD
      tmhmm: ---------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10923110.97comparative modeling1-14114110 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington