SSGCID - MygeA.17972.a 50S ribosomal protein L14 MG_161

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10532CompleteStructure predictionssgcidSSGCID - MygeA.17972.a 50...1224 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120  
   sequence: MVSFMTRLNVADNTGAKQVGIIKVLGATYKRYAFLGDVVVVSVKDAIPNGMVKKGQVLRAVIVRTKKGQQRQDGTHLKFHDNACVLIKEDKSPRGTRIFGPVARELREKGYNKILSLAVEVV
    spider3: ------EEEEE-----EEEEEEEE-------E-----EEEEEEEEE----------EEEEEEEEE---EE-----EEEE---EEEEE-----E---E---HHHHHHHH----EEEE------
 deepconcnf: ------EEEEEE-----EEEEEEEE------------EEEEEEEEE----------EEEEEEEE----EE-----EEEEE--EEEEE------EEEEEE-HHHHHHHH----HHH-------
    psipred: ----EEEEEE-------EEEEEEE-------------EEEEEEEE-----------EEEEEEEE-----------EEEE---EEEEE---------EE----HHHHH-----EEEE------
   disopred: --------------------------------------------------------------------------------------------------------------------------
      tmhmm: --------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10922111.00comparative modeling1-12212210 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington