SSGCID - MygeA.20080.a Thymidine phosphorylase MG_051

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10529CompleteStructure predictionssgcidSSGCID - MygeA.20080.a Th...4214 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190    .  200    .  210    .  220    .  230    .  240    .  250    .  260    .  270    .  280    .  290    .  300    .  310    .  320    .  330    .  340    .  350    .  360    .  370    .  380    .  390    .  400    .  410    .  420 
   sequence: MNIINLINKKQRGKALNLAEINWFVNAVLNKTIADYQITAFLMAIWFKGMNPNELFLLTKAMVDTGEIIKFNHHGKISVDKHSTGGIGDKVSLALVPILTSLGFSVAKLSGRGLGYTGGTIDKLEAVGVKTELTDQQAQACLDKNDCFIIGQSKDIAPVDKVLYGLRDITGTVDSLPLIASSIMSKKLAVMNEYIFIDLKYGKGAFCKTKKIANELAKLMQSIAKSFKRKLSVKLSDMNQVLGKAVGNVIEVNEAVNFLKQDLDQVGQDFIDLMQTIVINILLETKQAKTKQKAIELYQDVLTSKKAWNRFLSFIESQGGNVELFTQKEGFFKPKYKASIKAEKSGILHFTDPIDLAKIGINLGAGRMKKTDQIDPMAGLFLMKKDNESVAVGDTVLNLYSSSPISNEYISAAQKTIIINK
    psipred: --HHHHHHH--------HHHHHHHHHHHH-----HHHHHHHHHHHHH----HHHHHHHHHHHHH---EEE------------------HHHHHHHHHHHHH------EE----------HHHHHHH--------HHHHHHHHHHH-EEEEE----------HHHHHH--------HHHHHHHHHHHHHH----EEEEEE----------HHHHHHHHHHHHHHHHH----EEEEE-----HHHHHHHHHHHHHHHHHHH----------HHHHHHHHHHHHHHH------HHHHHHHHHHHHH--HHHHHHHHHHHH----HHHH--HHH-----EEEEEE----EEEEEE-HHHHHHHHHHH----------------EEEE-----------EEEEEEE--HHHHHHHHHHHHHEEE--
    spider3: --HHHHHHHHH------HHHHHHHHHHHH-----HHHHHHHHHHHHH----HHHHHHHHHHHHH---EEE-------EEEE-------HHHHHHHHHHHHH----EEEEE---------HHHHHHHH-------HHHHHHHHHHH--EEEE------HHHHHHHHHHHHHHHH-HHHHHHHHHHHHHHH----EEEEEEEE--------HHHHHHHHHHHHHHHHH----EEEEEE-----HHHHH--HHHHHHHHHHH----------HHHHHHHHHHHHHHH------HHHHHHHHHHHHH-HHHHHHHHHHHHH----HHHHH-HHH-----EEEEEE----EEEEEEEHHHHHHHHHHH---------------EEEEE-----EE----EEEEEEE----HHHHHHHHHHHEEE--
 deepconcnf: --HHHHHHHHH------HHHHHHHHHHHH-----HHHHHHHHHHHHH----HHHHHHHHHHHHHH------------EE--------HHHHHHHHHHHHHH---EEEEE----------HHHHHHH--------HHHHHHHHHHH--EEEE-------HHHHHHHH-----EE--HHHHHHHHHHHHHH----EEEEEE----------HHHHHHHHHHHHHHHHH----EEEEEE------------HHHHHHHHHHH--------HHHHHHHHHHHHHHHHH------HHHHHHHHHHHHH--HHHHHHHHHHHH------------------EEEEEE----EEEEEE-HHHHHHHHHHH----------------EEEE-----------EEEEEEE----HHHHHHHHH---E---
   disopred: ------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D
      tmhmm: -------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10894110.91comparative modeling1-42142110 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington