SSGCID - MygeA.00252.a Probable GTP-binding protein EngB MG_335

Job IDStatusMethodUsernameTargetLengthDate (PST)Expiration Date (PST)
10522CompleteStructure predictionssgcidSSGCID - MygeA.00252.a Pr...1914 Nov 2019-
             1   .   10    .   20    .   30    .   40    .   50    .   60    .   70    .   80    .   90    .  100    .  110    .  120    .  130    .  140    .  150    .  160    .  170    .  180    .  190 
   sequence: MDAHFLKSASDLKDCPQDNIPEICFMGRSNVGKSSLINAFFKKKLAKTSATPGRTQLLNYFEYKDKRFVDLPGYGFAKINKNKKDFITNLLTQFLNFRSNLVGVVLIVDSGVVTVQDQEVVKIILQTGLNFLIVANKFDKLNQSERYFSLKNIANFLKVNFDKCVFASTKTHHNLALVHKKIFELFVEDER
    psipred: --EEEEEE---HHH-------EEEEE------HHHHHHHHH---------------EE--EEE--EEEE-------EE--HHHHHHHHHHHHHHHH--HHHEEEEEEEE-----HHHHHHHHHHHH----EEEEEE------HHHHHHHHHHHHHHH------EEEEE------HHHHHHHHHHHHH----
    spider3: --EEEEEE---HHH-------EEEEE------HHHHHHHHH----EEE-----HHHHHHHH----EEEEE----------HHHHHHHHHHHHHHHH-----EEEEEEEE-----HHHHHHHHHHHHH---EEEEEE------HHHHHHHHHHHHHH-------EEEEE------HHHHHHHHHHHHH----
 deepconcnf: ---EEEEE--------------EEEEE-----HHHHHHHHH----EEE-------EEEEEEEE--EEEEE----------HHHHHHHHHHHHHHHHH----EEEEEEEE-----HHHHHHHHHHHH----EEEEEE------HHHHHHHHHHHHHHH-----EEEEE-------HHHHHHHHHHH------
   disopred: D--------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------D--DDDDD
      tmhmm: -----------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------------
| | View
Powered by 3Dmol.js.


Domain IDDomainParseConfidence Modeling MethodModel SpanLengthDate (PST)
10891110.98comparative modeling1-19119110 Nov 2019



Baker Lab | Rosetta@home | Contact | Terms of Service
©2020 University of Washington